Berlin Patient Essen Patient Age, gender 40y, male 27y, male Malignancy acute myeloid leukemia anaplastic large T-cell lymphoma Time between infection and ART 7 years 3 years Time between infection and Tx 12 years 5 years Tx regimen intermediate intensity myeloablative+12 Gy TBI Immunosuppression ATG, CSA, MTX, MMF ATG, CSA, MTX GvHD max. grade 1 (skin) max. grade1-2 (skin) Engraftment day +11 day +39 ART discont on day of Tx 7 days before Tx Viral load at Tx below detection below detection V3 sequence >3 months prior Tx* CIRPNNNTRKGIHIGPGRAYTTGEIIGDIRQAHC CTRPNNNTRKGIPLGPGKVFYAT-EIIRDIRKAYC X4 prediction** 3months prior Tx Immediate prior Tx capable not determined intermediate capable Disease control partial, relapse after 12 months no, relapse after 2 months ART:Anti-Retroviral Therapy; ATG:Aanti-ThymocyticGlobulin; CSA:Cyclosporine A; MMF:MycophenolateMofetil; MTX:Methotrexate; TBI:Total Body Irradiation;Tx: Transplantation

Table 1: Differences between ‘Berlin and Essen patients’ receiving CCRΔ32 homozygous allogeneic stem-cell transplantation. The viral tropism of HIV-1 was determined by genotyping the V3 amino acid sequence and applying Geno3Pheno bioinformatic software to predict viral coreceptor use (*discrepancy to the HIV type B V3 consensus sequence CTRPNNNTRKSIHIGPGRFYTTGEIIGDIRQAHC) are marked in bold and underlined; **DNA or RNA according to Geno3Pheno) [3-7,9]. There have been reported important differences in both cases: ART was discontinued one week before transplantation in ‘Essen’ patient. Furthermore, in the case of ‘Essen’ patient a more aggressive conditioning regimen was used and the patient had a very late engraftment (usually between 10-14 days as opposed to 39 days in ‘Essen’ patient).