Peptide families Sequences Theoretical MM (Da) Theoretical PI References
Phylloseptin        
PS-1 FLSLIPHAINAVSAIAKHN-NH2 2267.6 8.76 [12]
PS-2 FLSLIPHAINAVSTLVHHF-NH2 2367.7 7.02 [12]
PS-3 FLSLIPHAINAVSALANHG-NH2 2196.5 6.92 [12]
PS-4 FLSLIPHAINAVSTLVHHSG-NH2 2364.6 7.02 [12]
PS-5 FLSLIPHAINAVSAIAKHS-NH2 2240.5 8.76 [12]
PS-6 SLIPHAINAVSAIAKHF-NH2 2040.3 8.51 [12]
PLS-S2 FLSLIPHIVSGVASLAKHF-NH2 2287.6 8.77 [13]
PLS-S3 FLSLIPHIVSGVASLAIHF-NH2 2272.6 7.02 [13]
PLS-S4 FLSMIPHIVSGVAALAKHL-NH2 2255.7 8.77 [13]
PLS-S5 LLGMIPVAISAISALSKL-NH2 2048.5 8.76 [13]
PLS-S6 FLSLIPHIVSGVASIAKHL-NH2 2253.6 8.77 [13]
Nigrocin        
Nigrocin-1 GLLSGILGAGKHVVCGLSGLC 1954.3 8.07 [15]
Nigrocin-2 GLLGKILGVGKHIVCGLSGLC 2021.4 9.31 [15]
Nigrocin-OG12 GPLSGILGAGKHIVCGLSGLC 1952.3 8.07 [15]
Nigrocin-OG20 GLLSGVLGVGKKVLCGLSGLC 1973.4 8.90 [15]
Nigrocin-2GRa GLLSGILGAGKHIVCGLSGLC 1968.4 8.07 [15]
Nigrocin-2GRb GLFGKILGVGKKVLCGLSGMC 2080.6 9.39 [15]
Nigrocin-2GRc GLLSGILGAGKNIVCGLSGLC 1945.3 8.06 [15]
Nigrocin-2LVa GLLSKVLGVGKKVLCGVSGLC 2030.5 9.39 [19]
Nigrocin-2LVb GILSGILGMGKKLVCGLSGLC 2019.5 8.90 [19]
Nigrocin-2SCa GILSGILGAGKSLVCGLSGLC 1918.3 8.06 [19]
Nigrocin-2SCb GILSGVLGMGKKIVCGLSGLC 2005.5 8.90 [19]
Nigrocin-2SCc GILSNVLGMGKKIVCGLSGLC 2062.5 8.90 [19]
Nigrocin-2VB SILSGNFGVGKKIVCGLSGLC 2052.4 8.89 [19]
Nigrocin-2HJ GLLSKVLGVGKKVLCGVSGLC 2030.5 9.39 [19]
Japonicin        
Japonicin-1 FFPIGVFCKIFKTC 1650.0 8.90 [21]
Japonicin-2 FGLPMLSILPKALCILLKRKC 2358.0 9.85 [21]
Japonicin-1CDYa FFPLALLCKVFKKC     [23]
Japonicin-2CHa FVLPLLGILPKELCIVLKKNC 2354.0 8.86 [22]
Japonicin-2CHb VVPAFVLLKKAICIMLKRNC 2259.9 9.85 [22]
Japonicin-2CHc VVPAFVLLRKAICIMLKRNC 2287.9 10.11 [22]
Japonicin-2CHd VVPAFVLLKKAICIMFKRNC 2293.9 9.85 [22]
Palustrin        
Palustrin-1 ALFSILRGLKKLGKMGQAFVNCEIYKKC 3159.9 9.79 [24]
Palustrin-2 GFLSTVKNLATNVAGTVLDTIRCKVTGGCRP 3192.7 9.50 [24]
Palustrin-3 GIFPKIIGKGIKTGIVNGIKSLVKGVGMKVFKAGLNNIGNTGCNEDEC 4933.8 9.45 [24]
Palustrin-OG1 GLWDTIKQAGKKFFLNVLDKIRCKVAGGCRT 3467.1 9.90 [24]
Palustrin-OG2 KKFFLKVLTKIRCKVAGGCRT 2397.0 10.59 [27]
Palustrin-2CG1 GLWNTIKEAGKKFAINYLDKIRCGIAGGCKT     [25]
Palustrin-2Cha GLLSTFKNLATNVAGTVIDTLKCKVTGGCRT 3182.7 9.39 [28]
Palustrin-2ISa GFMDTAKNVAKNVAVTLLDKLKCKITGGC 3039.6 9.24 [29]
Palustrin-2ISb GLWNSIKIAGKKLFVNVLDKIRCKVAGGCKTSPDVE 3888.6 9.51 [29]
Parkerin GWANTLKNVAGGLCKITGAA 1945.2 9.31 [30]
Jingdongin        
Jingdongin-1 FLPLFLPKIICVITKKC 1976.6 9.39 [33]
Jingdongin-2 FLPIVENCSLVCWENNQKC 2239.6 4.59 [33]
Medusin        
Medusin-AC LLGMIPLAISAISALSKL 1811.3 8.75 [34]
Medusin-PH LLGMIPVAISAISALSKL 1797.2 8.75 [34]
Medusin-PD LLGMIPLAISAISSLSKL 1827.3 8.75 [34]
Limnonectin        
Limnonectin-1Fa SFPFFPPGICKRLKRC 1896.3 10.11 [35]
Limnonectin-1Fb SFHVFPPWMCKSLKKC 1938.4 9.39 [35]
Hylaranin        
Hylaranin-1 GVLSAFKNALPGIMKIIV-NH2 1871.3 10.00 [36]
Hylaranin-2 GVLSVIKNALPGIMRFIA-NH2 1899.3 11.00 [36]
MM: Molecular mass; PI: isoelectric point;Underlined: Sequence fragments containing two cysteine residues responsible to form intermolecular disulfide bonds at the C-terminal region (Rana Box).
Table 1: Primary sequence, theoretical molecular masses and isoelectric points of amphibian AMP families.