Id protein Id patient Protein sequence Strain Family Type
St-20245-0-I13V-L63A 20245 PQITLWQRPLVTVKIGGQLKEAL
LDTGADDTVLEE
MNLPGRWKPKMIGGIGGFIK
VRQYDQIAIEICGHKAIGTVLVGPT
PVNIIGRNLLTQIGCTLNF
Unknown Protease HIV-1
St-19227-0-P39S-L63P-A71T 19227 PQITLWQRPLVTIKIGGQ
LKEALLDTGADDTVLEEMNLSGRWKPK
MIGGIGGFIKVRQYDQIPIEICGHKTIGTV
LVGPTPV NIIGRNLLTQIGCTLNF
Unknown Protease HIV-1
Sw-O41798   PQITLWQRPLVTVKIGGQLIEALLDTGADDTVLEGI
NLPGKWKPKMIGGIGGFIKVRQYDQILIEIGGKKA
IGTVLVGPTPINIIGRNMLTQIGCTLNF
M Protease HIV-1
Sw-O89290   PQITLWQRPLVTIRVGGQLKEALLDTGADDTVLEDVN
LPGKWKPKMIGGIGGFIKVKQYDSILIEICGHRAIGTV
LVGPTPVNIIGRNMLTQIGCTLHF
M Protease HIV-1
Table 3: Sample selection extracted from the protein table.