alexa Cloning and Expression of Truncated Chlamydial Major Outer Membrane Protein in E.coli: A Miniature Step Forward | OMICS International
ISSN: 2157-7560
Journal of Vaccines & Vaccination

Like us on:

Make the best use of Scientific Research and information from our 700+ peer reviewed, Open Access Journals that operates with the help of 50,000+ Editorial Board Members and esteemed reviewers and 1000+ Scientific associations in Medical, Clinical, Pharmaceutical, Engineering, Technology and Management Fields.
Meet Inspiring Speakers and Experts at our 3000+ Global Conferenceseries Events with over 600+ Conferences, 1200+ Symposiums and 1200+ Workshops on
Medical, Pharma, Engineering, Science, Technology and Business

Cloning and Expression of Truncated Chlamydial Major Outer Membrane Protein in E.coli: A Miniature Step Forward

Razieh Bitazar1,2, Taghi Naserpour Farivar1*, Bahareh Hajikhani2*, Rezvan Bagheri2 and Ali Salimi3

1Cellular and Molecular Research Center, Qazvin University of Medical Sciences, Qazvin, Iran

2Reproductive Biotechnology Research Center, Avicenna Research Institute, ACECR, Tehran, Iran

3Monoclonal Antibody Research Center, Avicenna Research Institute, ACECR, Tehran, Iran

*Corresponding Author:
Taghi Naserpour Farivar
Cellular and Molecular Research Center
Qazvin University of Medical Sciences, Qazvin, Iran
Tel: +98 281 3336002; +98 21 22432020
E-mail: [email protected]
Bahareh Hajikhani
Reproductive Biotechnology Research Center
Avicenna Research Institute, ACECR, Tehran, Iran
E-mail: [email protected]

Received date: December 21, 2013; Accepted date: January 25, 2014; Published date: January 28, 2014

Citation: Bitazar R, Farivar TN, Hajikhani B, Bagheri R, Salimi A (2014) Cloning and Expression of Truncated Chlamydial Major Outer Membrane Protein in E.coli: A Miniature Step Forward. J Vaccines Vaccin 5:217. doi: 10.4172/2157-7560.1000217

Copyright: © 2014 Bitazar R, et al. This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited.

Visit for more related articles at Journal of Vaccines & Vaccination

Abstract

Administration of Prophylactic vaccines still is the cutting-edge of prevention, control and elimination of infections. Among the common causes of sexually transmitted diseases, chlamydia trachomatis is an important socioeconomic burden worldwide which impairs human genital tract function, resulting in severe complications like urethritis, pelvic inflammatory disease (PID), getting ease of HIV transmission, playing cofactor role in human papilloma virus (HPV)- induced cervical neoplasia, and unfortunately infertility. Because of all difficulties, vaccination is considered to be the most economical and reliable way to escape from unrestrained exacerbation states of infection than any other prevalence program. But despite much advancement in the field of veterinary, the dream has yet to be realized. Among a number of potential candidates, the major outer membrane protein (MOMP) is a vanguard of subunit vaccines. In this attempt, MOMP216 gene fragment cloned in PET28b+ and expressed in E.coli. The protein expression confirmed by SDS-PAGE. These findings demonstrate that, considering the antigenicity prediction and due to the existence of potential epitopic region, rMOMP216 could be a potential capable peptide which can represent as an alternative to whole MOMP.

Keywords

Chlamydia trachomatis; MOMP (Major Outer Membrane Protein); Vaccine

Introduction

Worldwide hurricane of 92 million cases of chlamydia trachomatis infection was estimated by WHO in 2001 [1]. High prevalence of sexually transmitted infections in Europe [2] and in the United States [3] would recommend it as a leading cause of cervicitis, pelvic inflammatory disease (PID), Salpingitis, ectopic pregnancy and infertility [4]. It is too prevalent in developing countries [5]. Chlamydia as a mucosotropic [6] intracellular bacterium is a facilitating factor of HIV transmission and also is a cofactor of HPV-induced cervical neoplasia [7]. Thus, administration of vaccine absolutely is necessary to save $2 billion per year [8]. The perfect protection model is focused on subunit vaccine using major outer membrane protein (MOMP) [9]. Among different proteins of chlamydial, MOMP as an immunodominant, Surface- Exposed antigen is mostly investigated as the best potentially candidate for a subunit vaccine. MOMP is greatly antigenic which known as a porin and the representative of Peptidoglycan layer [10]. In this attempt, beside molecular gene cloning and protein expression methods in prokaryotic system, antigenic domain of MOMP were predicted using prediction tools. Our suggestion is that MOMP160-376 which named rMOMP217 during this paper would be a new member of potentially vaccine candidate among collection investigated during so many years. But undoubtedly this present study needs further experimental works to develop an effective vaccine instead of both therapeutic and prophylactic proceedings.

Materials and Methods

Bacterial strains And Vector

Chlamydia trachomatis strain L1/440, E.coli DH5α and E.coli BL21 (DE3) for cloning and Expression experiments were obtained from Avicenna Research Institute Microbial Bank. pET28b expression vector was also provided from Avicenna Research Institute.

PCR Amplification

MOMP217 was amplified with Taq DNA polymerase (Vivantis). Primers were designed with BamHI and HindIII restriction sites at the 5` of forward and reverse, respectively. Primers designed to amplify MOMP217 gene fragment (corresponding to nucleotides 160-376) was according to information retrived from NCBI data Bank. The forward primer incorporated a BamHI restriction enzyme site (bold) and a start codon (underlined) with the sequence, 5’-GTTGGGGATCCTGGAGATAATGAAAAT-3’ and the reverse primer incorporated a HindIII site (bold) and a stop codon (underlined), 5’-ACTCTAAGCTTCTCAACTGTAACTGCGTATTT-3’. In brief Total volume of each reaction was 25 μl which consisted of 1mM of each primer, 10X PCR buffer 0.6 mM dNTPs, 5 mM MgCl2, 1.0 U Taq polymerase (Vivantis) and 1 μl of the template DNA. PCR condition were as follow: initial denaturing at 95°C for 5 min, 40 cycles including 30s at 95°C, 30 s at 53.5°C, 1/30 s at 72°C and a final extension at 72°C for 5 min. Hence, the expected 674 bp band was purified directly with clean-up process using Qiagen purification kit buffers.

Bioinformatic

Amino acid sequence of MOMP in FASTA format was elicited from protein data bank. There is no available evidence from 3D structure of MOMP in PDB (Protein Data Bank). Prediction of antigenic domain of MOMP was performed by Kolaskar and Tonaonkar method.

Secondary structure of MOMP serovar L1 was predicted by GOR (Garnier-Osguthorpe-Robson). Multiple Alignments between serovar E, L1, L2 and L3 for detecting the conserved common regions was performed by European Bioinformatics Institute website.

Cloning of PET-MOMP216

PCR was performed to amplify the MOMP217 containing epitopic regions with specific primers. Qiagen gel extraction kit (Qiagen, Hilden, Germany) was used to purify PCR amplified product and plasmid DNA. Purified plasmid and amplified insert were double digested with BamHI and HindIII (Fermentase). The digested products were purified and ligated into linearised and purified vector withT4 DNA ligase enzyme(Fermentase), then ligation mixture were transformed into E.coli DH5α cloning host. As well, Recombinant clones were confirmed by colony PCR and double digestion. The confirmed purified DH5α/ pET- MOMP217 positive colony were transformed and cloned into E.coli BL21 (DE3) expression host and used for protein expression purpose with IPTG.

Protein expression

E.coli BL2 (DE3) with T7 promoter, harboring the PET- MOMP217 (24kDa) positive colony were grown in 100 ml LB broth at 37°C including 100 μg/ml kanamycin (Sigma) to achieve an optical density (OD) of 0.7 (stationary growth phase) at 600 nm at this time, 1 mM isopropyl-ß-D-thiogalactoside (IPTG; Invitrogen) were added to 50 ml LB broth and the other same amount were considered as uninduced (-IPTG) control. Incubation was continued at 37°C. The samples from induced and uninduced culture were collected within 2, 4, 6 hours and overnight after induction. Incubation temperature in the case of overnight was reduced to 25°C. Samples were accumulated, centrifuged at 6000 rpm for 5 min. Harvested cells were resuspending with 2x loading protein buffer containing 2-ME, boiled and subjected to SDSPAGE analysis. Total protein expression trend were evaluated by 10% SDS-PAGE stained with Comassie Brilliant Blue. SDS-PAGE were shown to have one band corresponded to recombinant protein which were termed as rMOMP217 (Table
1
).

           .   10    .   20    .   30    .   40    .   50
MKKLLKSVLVFAALSSASSLQALPVGNPAEPSLMIDGILWEGFGGDPCDP epitope    +++++++++++++++++++++++++ +++++++++      ++++++
           .   60    .   70    .   80    .   90    .  100
CTTWCDAISMRMGYYGDFVFDRVLQTDVNKEFQMGAKPTATTGNAAAPST epitope ++++++++       ++++++++++++                      
           .  110    .  120    .  130    .  140    .  150
CTARENPAYGRHMQDAEMFTNAAYMALNIWDRFDVFCTLGATSGYLKGNS epitope                                +++++++++         
           .  160    .  170    .  180    .  190    .  200
ASFNLVGLFGDNENQSTVKKDAVPNMSFDQSVVELYTDTTFAWSVGARAA epitope   +++++++                   ++++++++     +++++++++
           .  210    .  220    .  230    .  240    .  250
LWECGCATLGASFQYAQSKPKVEELNVLCNAAEFTINKPKGYVGKEFPLD epitope ++++++++++++++++++++++++++++++++       +++++++   
           .  260    .  270    .  280    .  290    .  300
LTAGTDAATGTKDASIDYHEWQASLALSYRLNMFTPYIGVKWSRASFDAD epitope                     ++++++++++     ++++++++      
           .  310    .  320    .  330    .  340    .  350
TIRIAQPKLATAIFDTTTLNPTIAGAGEVKANAEGQLGDTMQIVSLQLNK epitope  ++++++++++++                           ++++++++ 
           .  360    .  370    .  380    .  390
MKSRKSCGIAVGTTIVDADKYAVTVETRLIDERAAHVNAQFRF
epitope     ++++++++++++++++++++++++     +++++++

Table 1: Prediction of Antigenic Region of Chlamydia Trachomatis Serovar L1.

Results

Recombinant plasmid

The MOMP217=truncated omp1, was amplified by polymerase chain reaction. Then, digested insert and linearised plasmid associated, pET28b, were ligated and cloned into E.coli DH5α cloning host resulting DH5α /PET-MOMP217 Recombinant clones were transferred into BL21 expression host concluding BL21/PET-. MOMP217.

Expression of recombinant protein

The expression of rMOMP217 was induced by adding IPTG in 1 mM final concentration. The mass of rMOMP in induced and uninduced culture were evaluated by SDS-PAGE. The 24 kDa molecular mass was not noticeable in uninduced cells whereas was recognizable within 2, 4, 6 hours and over night after induction.

Bioinformatic and antigenicity prediction research

The multiple alignments of the MOMP sequences by clustalw2 helped to determine conserved common regions between L1, L2, L3 and E serovars respectively. This experiment showed high similarity in conserved domain. C.Trachomatis serovar L1 was as a template in the entire of study. Crucial attributes of antigenic epitopes are flexibility and hydrophilicity; secondary structure prediction by GOR shown flexible region like random coil. Antigenicity prediction by Kolaskar and Tonaonkar method demonstrated antigenic domain which were shown by plus.

Discussion

Is Vaccinology almost forgotten? To be frank, neither screening programs nor controlling trials are able to overcome the threats about reproductive issue. Whereas, Vaccination is unequivocally pivotal to tackle the diseases. It has also been one of the most important health advances in history. Approximately, 92 million young adults suffer from this considerable public health concern [11]. Therefore, vaccination is an important strategy not only for chlamydiosis but also for other STIs [12]. Complications like ectopic pregnancy, pelvic inflammatory disease (PID) and infertility suggest more attention on this turbulent, silent and unfortunately neglected disease. Particularly, for women lack of a protective vaccine has existed as the health problem. Data were gathered from multiple sources at various time points noticed the importance of MOMP as a subunit vaccine candidate. MOMP, encoded by OmpA gene, has been the antigen tested in many investigational studies and known as a primary of vaccine development [13]. MOMP is a promising, immunodominant and Surface-Exposed antigen which is able to stimulate both humoral and cellular immunity [14]. To date, no vaccine licensed for human use is available. This view is supported by A. Feher who writes “a prophylactic vaccine has long been sought against C.trachomatis but has yet to be obtained” [15]. Moreover, despite advancement in the field of veterinary currently there is, however, no human protective vaccine [16]. Also, orientations of newly strategies in “OMICS” technology like vaccinomics are trying to produce an effective vaccine that would serve immunity against genital chlamydiosis [17]. In the history of vaccine development, single or multisubunit vaccine is the major focus of chlamydial Vaccinology [18]. Harmful effect of whole organism, as well reverting to a virulent form has shifted in subunit vaccine toward the first generation vaccine [19]. Despite the necessity of additional factors like delivery system and adjuvant [15], for both immunocompromised patients and pregnant women who can’t safely take live vaccinations it would be an effective alternative. Human subunit vaccines are currently available against pneumococci, meningococci, Haemophilus influenza, and hepatitis B and influenza virus [20]. But to improve the insight into designing an effective vaccine, it is crucial to get concrete knowledge about immunological aspect of this infection, besides the role of both humoral and cellular immunity as two arms of immune system. Indeed, successful protection requires the stimulation of T-cell in addition to antibody responses [21]. In the current study, we were being able to predict precisely antigenic region through bioinformatic and antigenicity prediction tools to produce a truncated protein instead of a full-length. Truncated protein’s nature reflecting this reality that short segment derive from protein make it more appropriate to fuse with other genes to construct a fusion protein. Not long ago, novel B-cell epitopes containing mostly conserved region and high antigenicity. They were MOMP73-81, MOMP161-175, MOMP217-225, MOMP261-270 and MOMP377-386 in the N-terminal region. Surprisingly MOMP377-386 was the strongest epitope followed by challenging in mice [22]. It is undoubtedly true that B-cell responses are essential. However, T-cell derived immune response and peptides including T-cell epitopes due to the significant role of CTL and Th during infection are absolutely important. Also, the small fragment of MOMP containing T-cell epitope, rMOMP278, was able to elicit both systemic, mucosal and a balanced Th1/Th2 immune responses [23]. It would be a valuable candidate in order to formulate a T-cell vaccine. Regarding to our research, MOMP217 were expressed as 6xHis-tagged protein. SDS-PAGE analysis confirmed desired expression condition and showed that this expressed protein could readily purify with Ni- NTA affinity chromatography. To construct a recombinant plasmid, pET28b were used as an expression vector. This approach has an attractive feature that during protein purification, pET28b needs Thrombin to remove fusion tag, while other like pET32a resulting Trx-His-tag needs one more expensive enzyme like Enterokinase to remove the fusion tag. The mentioned fusion tag make an intervention in protein activity; obviously whenever total protein inject to animals, antibodies would elicit against both targeted protein and fusion tag. Thus, purification of protein in prokaryotic expression system with purification affinity tag like 6-His tag is easier than other vectors. It has a little influence on protein function because 6-His belongs to the insert amino acids with poor immunogenicity and is easy to remove [24]. The highest throughput of protein expression obtained at 30°Cto produce recombinant Hemoglobin II from Lucina pectinata [25]. A recent study optimized the convenient condition for mature PsaA expression in Escherichia coli for about 16 h at 25°C with 0.1 mM IPTG in Terrific Broth medium [26]. Taken together, these findings have tended to focus on optimal condition for protein expression. Growth in 37°C resulted in accumulation of inclusion body while incubation in 25°C produce more soluble form of protein, in fact this temperature helps the bacteria to consume all energy toward protein biosynthesis and not cell division. It may be explained by the fact that night expression without any needs to follow is the best system to increase the yield of protein expression. To our knowledge, the truncated protein in this study is a first report and contains some important epitopic region. The result for SDS-PAGE demonstrate that our constructed prokaryotic system PET28b-BL21 MOMP217 (DE3) produce target recombinant protein. The current investigation was limited by economical problem as a big issue in developing countries. Accordingly, more research on this topic needs to be attempted before introducing as a vaccine candidate. Therefore, further empirical researches on the current study are recommended. Since, massive improvement is needed in human vaccine, recent developments have heightened a convenient adjuvant and delivery system for a human vaccine. The vaccine needs to promote two CMI and antibody response, CAF01 is an adjuvant that is appropriate to enter human clinical trials in future [27]. CPG and Montanide are two other adjuvants that are now in clinical trials [28,29]. In addition, Novel delivery systems, including Vibrio cholerae ghosts and cationic liposomes, may have the potential to elicit protective responses against chlamydial genital infection when used in conjunction with appropriate antigens [30]. To summarize, if the debate is to move forward, a better understanding of more delivery systems and eligible adjuvant needs to be developed. As well, better technological possibilities combined with proteomics, immunology and immunoinformatic, allow for new vaccination strategies (Figures 1 and 2).

vaccines-vaccination-primer-design

Figure 1: Schematic representation of primer design with BamHI and HindIII.

vaccines-vaccination-induction-time

Figure 2: SDS-PAGE analysis of MOMP216 at different induction time.
U: uninduction (-IPTG)
I: Induction (+IPTG) restriction sites.

Acknowledgement

Support from the Avicenna Research Institute is gratefully acknowledged. We thank Rezvan Bagheri and H.Heidari-Vala from Avicenna Research Institute for cordially help in manuscript editing.

References

Select your language of interest to view the total content in your interested language
Post your comment

Share This Article

Article Usage

  • Total views: 12115
  • [From(publication date):
    February-2014 - Apr 26, 2018]
  • Breakdown by view type
  • HTML page views : 8346
  • PDF downloads : 3769

Review summary

  1. Dr Thomas
    Posted on Jun 20 2016 at 2:45 am
    Are you in any kind of financial difficulties? Do you need loan? Are you losing sleep at nights worrying how to get a Loan? Don't allow your dreams to die.Contact Email: [email protected] with the following details.. Full Names: Contact Address: Amount Required: Duration Of Loan: Cell Phone Number: Country: Regards, Contact us now Via this Email: [email protected] Dr Thomas
 

Post your comment

captcha   Reload  Can't read the image? click here to refresh

Peer Reviewed Journals
 
Make the best use of Scientific Research and information from our 700 + peer reviewed, Open Access Journals
International Conferences 2018-19
 
Meet Inspiring Speakers and Experts at our 3000+ Global Annual Meetings

Contact Us

Agri & Aquaculture Journals

Dr. Krish

[email protected]

1-702-714-7001Extn: 9040

Biochemistry Journals

Datta A

[email protected]

1-702-714-7001Extn: 9037

Business & Management Journals

Ronald

[email protected]

1-702-714-7001Extn: 9042

Chemistry Journals

Gabriel Shaw

[email protected]

1-702-714-7001Extn: 9040

Clinical Journals

Datta A

[email protected]

1-702-714-7001Extn: 9037

Engineering Journals

James Franklin

[email protected]

1-702-714-7001Extn: 9042

Food & Nutrition Journals

Katie Wilson

[email protected]

1-702-714-7001Extn: 9042

General Science

Andrea Jason

[email protected]

1-702-714-7001Extn: 9043

Genetics & Molecular Biology Journals

Anna Melissa

[email protected]

1-702-714-7001Extn: 9006

Immunology & Microbiology Journals

David Gorantl

[email protected]

1-702-714-7001Extn: 9014

Materials Science Journals

Rachle Green

[email protected]

1-702-714-7001Extn: 9039

Nursing & Health Care Journals

Stephanie Skinner

[email protected]

1-702-714-7001Extn: 9039

Medical Journals

Nimmi Anna

[email protected]

1-702-714-7001Extn: 9038

Neuroscience & Psychology Journals

Nathan T

[email protected]

1-702-714-7001Extn: 9041

Pharmaceutical Sciences Journals

Ann Jose

[email protected]

1-702-714-7001Extn: 9007

Social & Political Science Journals

Steve Harry

[email protected]

1-702-714-7001Extn: 9042

 
© 2008- 2018 OMICS International - Open Access Publisher. Best viewed in Mozilla Firefox | Google Chrome | Above IE 7.0 version