alexa Mapping Zaire Ebola Virus Glycoprotein Organization onto Information Entropy | Open Access Journals
ISSN: 2161-0703
Journal of Medical Microbiology & Diagnosis
Like us on:
Make the best use of Scientific Research and information from our 700+ peer reviewed, Open Access Journals that operates with the help of 50,000+ Editorial Board Members and esteemed reviewers and 1000+ Scientific associations in Medical, Clinical, Pharmaceutical, Engineering, Technology and Management Fields.
Meet Inspiring Speakers and Experts at our 3000+ Global Conferenceseries Events with over 600+ Conferences, 1200+ Symposiums and 1200+ Workshops on
Medical, Pharma, Engineering, Science, Technology and Business

Mapping Zaire Ebola Virus Glycoprotein Organization onto Information Entropy

Joel K Weltman*

Clinical Professor Emeritus of Medicine, Alpert Medical School, Brown University, USA

*Corresponding Author:
Weltman JK
Clinical Professor Emeritus of Medicine
Alpert Medical School, Brown University, USA
Tel: 401/245-7588
E-mail: [email protected]

Received date: April 15, 2015; Accepted date: April 16, 2015; Published date:April 18, 2015

Citation: Weltman JK (2015) Mapping Zaire Ebola Virus Glycoprotein n Organization onto Information Entropy. J Med Microb Diagn 4:e128. doi:10.4172/2161-0703.1000e128

Copyright: © 2015 Weltman JK. This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited.

Visit for more related articles at Journal of Medical Microbiology & Diagnosis

Keywords

Zaire ebola virus; ZEBOV; Glycoprotein GP1,2; Information entropy; Receptor binding domain (RBD); Fusion loop (FL); Escape mutants

Editorial

Ebola glycoprotein GP1,2 performs functions which are essential for the binding of virus to the target cell membrane and subsequent internalization and processing by the target cell [1]. This journal has recently published an analysis of the information entropy (H) of a dataset comprised of Zaire and Sudan Ebola virus (ZEBOV and SEBOV) glycoprotein GP1,2 sequences [2]. The current epidemic of Ebola virus disease (EVD) is caused exclusively by viruses of the ZEBOV strain (http://www.who.int/mediacentre/factsheets/fs103/en/). Accordingly, this Editorial focuses on the potential significance and usefulness of the H distribution [3] in analyzing ZEBOV GP1,2 proteins.

The complete set of ZEBOV GP1,2 amino acid sequences (N=139) was downloaded in FASTA format using the NCBI Ebolavirus Resource (http://www.ncbi.nlm.nih.gov/genome/viruses/variation/ebola/) on March 26, 2015. Determination of information entropy and graphing of the results were performed with 64-bit Enthought Python 2.7.6 as previously described. In this research, data are presented as summations of H in order to enhance the visualization of the organization of H distribution over the entire length of 676 amino acids that comprise the ZEBOV GP1,2 protein. In this representation, mutating regions are represented as regions in which equation > 0.0 where n is amino acid position. Non-mutating regions in the protein sequences are represented as regions in which equation > 0.0

The H distribution obtained for the ZEBOV GP1,2 set of sequences is shown in (Figure 1). The slope equation of the distribution was equal to zero from positions 17 to 81 and from positions 83 to 218. There was a steep increase in slope beginning at position 296, ending at position 455. There was zero slope from position 504 to 543, with rare mutation from position 545 to the C-terminal phenylalanine.

medical-microbiology-diagnosis-Information-Entropy

Figure 1: Summed Information Entropy (H) and Functional Organization of ZEBOV Glycoprotein GP1,2.

The following regions of the GP1,2 protein have been reported to have special features and functions, some of which are essential for Ebola virus replication, infectivity, transmission and mutational escape : signal peptide [4], receptor binding domain [5,6], glycan cap [7,8], mucin-like domain [8] and fusion loop [6,9,10].These regions have the following distribution (amino acid positions in parentheses): signal peptide (1-31), receptor binding domain (54-201), glycan cap (202- 309), mucin-like domain (310-500) and fusion loop (507-560).

The distribution of sum(H) as a function of n for ZEBOV GP1,2 is shown in (Figure 1). The slope is close to zero until position 82, which is a mutating site. There is a zero slope, ie, with no mutation, from positions 83 to 218. A much greater equation slope, indicating the accumulation of mutants, began at position 262 and persisted through position 503 of the GP1.2 sequence dataset. The equation slope was again zero from position 504 until position 543, and remained close to zero until, and including the C-terminus at position 676.

The mucin-like domain (MLD) is the region of ZEBOV GP1,2 that displayed the greatest accumulation of mutants. In contrast, the receptor binding domain (RBD) and the fusion loop (FL) both occupied ZEBOV GP1,2 regions that displayed little, if any, tendency to mutate.

The tendency towards zero H displayed by both the RBD and the FL regions of GP1,2 suggests that these regions may be under biological constraints that restrict the ability of mutations to occur or for mutated sequences to persist. It is proposed that these invariant positions may be useful as immunologic or therapeutic targets with an inherent stability that mitigates against mutational escape.

The amino acid sequence (83-218) that includes mainly the RBD, length=136 with H=0 at all positions, is:

TKRWGFRSGVPPKVVNYEAGEWAENCYNLEIKKPDGSECLPAAPDGIRGF PRCRYVHKVSGTGPCAGDFAFHKEGAFFLYDRLASTVIYRGTTFAEGVVAFL ILPQAKKDFFSSHPLREPVNAT EDPSSGYYSTTI

The amino acid sequence (504-543) that includes mainly the FL, length=40 with H=0 at all positions, is:

IVNAQPKCNPNLHYWTTQDEGAAIGLAWIPYFGPAAEGIY IVNAQPKCNPNLHYWTTQDEGAAIGLAWIPYFGPAAEGIY

As of this writing, the 2013-2015 epidemic of Ebola virus disease (EVD) in West Africa, caused by ZEBOV, has produced 25,556 cases and 10,587 deaths (http://www.cdc.gov/vhf/ebola/outbreaks/2014- west-africa/case-counts.html). It is proposed that these two invariant GP1,2 peptides detected by information entropy may be useful for development of anti-ZEBOV preventive vaccines and pharmaceutical agents.

References

Select your language of interest to view the total content in your interested language
Post your comment

Share This Article

Relevant Topics

Recommended Conferences

  • 10th World Congress on Alzheimers Disease & Dementia
    May 30-31, 2018 Osaka, Japan
  • 4th World Congress and Exhibition on Antibiotics and Antibiotic Resistance
    June 14-15, 2018 Barcelona, Spain
  • 4th Annual Congress on Infectious Diseases  
    September 17-18, 2018 San Diego, USA
  • 13th World Congress on Virology
    September 26-27, 2018 Montreal, Canada

Article Usage

  • Total views: 11657
  • [From(publication date):
    June-2015 - Nov 21, 2017]
  • Breakdown by view type
  • HTML page views : 7876
  • PDF downloads : 3781
 

Post your comment

captcha   Reload  Can't read the image? click here to refresh

Peer Reviewed Journals
 
Make the best use of Scientific Research and information from our 700 + peer reviewed, Open Access Journals
International Conferences 2017-18
 
Meet Inspiring Speakers and Experts at our 3000+ Global Annual Meetings

Contact Us

Agri & Aquaculture Journals

Dr. Krish

[email protected]

1-702-714-7001Extn: 9040

Biochemistry Journals

Datta A

[email protected]

1-702-714-7001Extn: 9037

Business & Management Journals

Ronald

[email protected]

1-702-714-7001Extn: 9042

Chemistry Journals

Gabriel Shaw

che[email protected]

1-702-714-7001Extn: 9040

Clinical Journals

Datta A

[email protected]

1-702-714-7001Extn: 9037

Engineering Journals

James Franklin

[email protected]

1-702-714-7001Extn: 9042

Food & Nutrition Journals

Katie Wilson

[email protected]

1-702-714-7001Extn: 9042

General Science

Andrea Jason

[email protected]

1-702-714-7001Extn: 9043

Genetics & Molecular Biology Journals

Anna Melissa

[email protected]

1-702-714-7001Extn: 9006

Immunology & Microbiology Journals

David Gorantl

[email protected]

1-702-714-7001Extn: 9014

Materials Science Journals

Rachle Green

[email protected]

1-702-714-7001Extn: 9039

Nursing & Health Care Journals

Stephanie Skinner

[email protected]

1-702-714-7001Extn: 9039

Medical Journals

Nimmi Anna

[email protected]

1-702-714-7001Extn: 9038

Neuroscience & Psychology Journals

Nathan T

[email protected]

1-702-714-7001Extn: 9041

Pharmaceutical Sciences Journals

Ann Jose

[email protected]

1-702-714-7001Extn: 9007

Social & Political Science Journals

Steve Harry

[email protected]

1-702-714-7001Extn: 9042

 
© 2008- 2017 OMICS International - Open Access Publisher. Best viewed in Mozilla Firefox | Google Chrome | Above IE 7.0 version
adwords