alexa Study Hydrophobicity and Antigenicity of Cytochrome C Oxidase Subunit II from D. medinensis: New Prototype of Synthetic Vaccine Development | OMICS International
ISSN: 2469-9756
Immunochemistry & Immunopathology
Like us on:
Make the best use of Scientific Research and information from our 700+ peer reviewed, Open Access Journals that operates with the help of 50,000+ Editorial Board Members and esteemed reviewers and 1000+ Scientific associations in Medical, Clinical, Pharmaceutical, Engineering, Technology and Management Fields.
Meet Inspiring Speakers and Experts at our 3000+ Global Conferenceseries Events with over 600+ Conferences, 1200+ Symposiums and 1200+ Workshops on
Medical, Pharma, Engineering, Science, Technology and Business

Study Hydrophobicity and Antigenicity of Cytochrome C Oxidase Subunit II from D. medinensis: New Prototype of Synthetic Vaccine Development

Sonu Mishra and Virendra S Gomase*

Department of Biotechnology, Mewar University, Chittorgarh, India

*Corresponding Author:
Virendra S. Gomase
Department of Biotechnology
Mewar University
Chittorgarh, India
Tel: +9127743967
E-mail: [email protected]

Received date: December 11, 2015; Accepted date: January 07, 2016; Published date: January 12, 2016

Citation: Mishra S, Gomase VS (2016) Study Hydrophobicity and Antigenicity of Cytochrome C Oxidase Subunit II from D. medinensis: New Prototype of Synthetic Vaccine Development. Immunochem Immunopathol 2:113. doi:10.4172/2469-9756.1000113

Copyright: © 2016 Mishra S, et al. This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited.

Visit for more related articles at Immunochemistry & Immunopathology


Cytochrome c oxidase subunit II, also known as cytochrome c oxidase polypeptide II which is an oligomeric enzyme. In this study Cytochrome c oxidase subunit 2 (mitochondrion) protein has been used to investigate its role in antigenicity. Cytochrome c oxidase subunit 2 protein sequences (230 aa protein) is analyzed through different types B- cell epitope prediction methods. We found that the region of maximal hydrophilicity is likely to be an antigenic site, having hydrophobic characteristics, because the terminal regions of antigen protein is solvent accessible and unstructured, antibodies against those regions are also likely to recognize the native protein. It was seen that an antigen protein is hydrophobic in nature and contains segments of low complexity and high-predicted flexibility. The predicted antigenic protein segments of Cytochrome c oxidase subunit 2 can take active part in the host immune reactions. In future study the predicted antigenic protein Cytochrome c oxidase subunit 2 fragments can be used in the investigation of MHC molecules binding and it can be the first bottlenecks in vaccine design.


Antigen; Dracunculus medinensis; Epitope; Protein; Synthetic vaccine; Cytochrome c oxidase subunit II (mitochondrion)


Dracunculiasis, is caused by a 60-100 cm long nematode worm, Dracunculus medinensis, via a drinking of contaminated water infected with copepod Cyclops (intermediate host). Dracunculiasis has been known to humankind since antiquity. Guinea worm the largest tissue parasite with unusual life cycle with incubation period of the approximately more than a year with six developmental stages. This one of the most neglected tropic parasite which bears clinical importance and needs to be eradicated after small pox [1]. Mature and adult female after the copulation produces millions of eggs in its uterus, and is predominantly localized in the lower extremities (80-90%). After an incubation period the female worm release the larvae which induces a painful blister (1 to 6 cm diameter) on the skin of lower limbs; the person develop a slight fever, local skin redness, swelling and severe pruritus around the blister. Other symptoms include diarrhoea, nausea, vomiting and dizziness. The severity of the wound infections in the infected individual led to a more complications such as redness and swelling of the skin (cellulitis), boils (abscesses), generalized infection (sepsis), joint infections (septic arthritis) that can cause the joints to lock and deform (contractures), lock jaw (tetanus). The blister burst within 1 to 3 days and female worms one or more slowly comes out from the wounds which causes an excoriating burning sensation and pain [2,3]. Immersing or pouring water over the blister provides pain relief. But this the moment that adult female is exposed to the external environment [4]. During emergence of the limbs in open water sources it recognizes the temperature difference and releases the milky white liquid in the water which contains millions of immature larvae, when larvae released in water are ingested by copepods where they mount twice and become infective larvae within two weeks [5].

The D. medinensis antigen peptides can be most desirable segment for the subunit vaccine development because with the single epitope, the immune response can be generated in large population. This approach is usually based on the phenomenon of cross-protection, whereby infected with the mild strain and is protected against a more severe strain of the same. The phenotype of the resistant transgenic hosts includes fewer centers of initial infection, a delay in symptom development and low accumulation. In this study cytochrome c oxidase subunit II (mitochondrion) protein has been used to investigate its role in antigenicity. Cytochrome c oxidase subunit 2, also known as cytochrome c oxidase polypeptide II which is an oligomeric enzyme, an important component of the respiratory chain which involves in the transfer of electrons from cytochrome c to oxygen. This enzyme complex is found located in the mitochondrial inner membrane in eukaryotes. Cytochrome c oxidase subunit 2 contains two adjacent transmembrane regions in its N-terminus. The considerable part of the protein is generally exposed to the periplasmic or to the mitochondrial intermembrane space. The N-terminal domain of cytochrome C oxidase contains two transmembrane alpha-helices. Cytochrome oxidase deficiency and abnormality has been seen in the Leigh’s disease. Investigation shows that any alterations in the catalytic genes of cytochrome c oxidase subunits I and II (COI and COII) have an adverse impact on prognosis in patients with acute myeloid leukaemia (AML) [6,7]. A “mitochondrial hypothesis” of late onset Alzheimer’s disease (AD) has been proposed. The in depth biochemical studies propose that there is a significant decrease in cytochrome oxidase (CO) activity as well as perturbed CO I and CO III mRNA levels in platelets and brain tissue from Alzheimer’s patients. The phenotypic expression study of the CO mutation is the major reason for reduced CO activity and compromised mitochondrial function [8]. Antigen protein prediction from D. medinensis is necessary for few paradigms of synthetic vaccine development and target validation.


B-cell epitopes are the sites of molecules that are recognized by antibodies of the immune system. Knowledge of B-cell epitopes may be used in the design of vaccines and diagnostics tests. It is therefore of interest to develop improved methods for predicting B-cell epitopes [9]. In this research work, antigenic epitopes of antigen protein cytochrome c oxidase subunit II (mitochondrion) from D. medinensis is determined using the Gomase in 2007, Bepipred Linear Epitope Prediction, Emini Surface Accessibility Prediction, Karplus and Schulz Flexibility Prediction, Kolaskar and Tongaonkar Antigenicity, Parker Hydrophilicity Prediction [10-18].

Database searching

The antigenic protein sequence of Dracunculus medinensis Antigen cytochrome c oxidase subunit II was retrieved from, UniProt databases are initially the most important [19,20].

Prediction of antigenicity

Prediction of antigenicity program predicts those segments from cytochrome c oxidase subunit II protein that are likely to be antigenic by eliciting an antibody response. In this research work antigenic epitopes of cytochrome c oxidase subunit II from Dracunculus medinensis are determined by using the Hopp and Woods, Welling, Parker, Bepipred, Kolaskar and Tongaonkar antigenicity methods [21-24].

Solvent accessible regions

We also predict solvent accessible regions of proteins having highest probability that a given protein region lies on the surface of a protein Surface Accessibility, backbone or chain flexibility by Emini et al. [25] and Karplus and Schulz [26]. By using different scale we predict the hydrophobic and hydrophilic characteristics of amino acids that are rich in charged and polar residues i.e., Sweet et al. [27], Kyte and Doolittle [28], Abraham and Leo [29], Bull and Breese [30], Miyazawa et al. [31], Roseman [32], Wilson et al. [33], Cowan [34].

Results and Interpretation

The cytochrome c oxidase subunit II from Dracunculus medinensis, contain a long residue of 230 amino acids.


Prediction of antigenic peptides

In this study, we found the antigenic determinants by finding the area of greatest local hydrophilicity (Figure 1). The Hopp- Woods scale Hydrophilicity Prediction Result Data found high in position between 55-60 (55-SFEDDY-60) in a protein, assuming that the antigenic determinants would be exposed on the surface of the protein and thus would be located in hydrophilic regions (Figure 2). Welling antigenicity plot gives value as the log of the quotient between percentage in a sample of known antigenic regions and percentage in average proteins and Prediction Result Data found high in position 142-146 (142- VDNRC-146) (Figure 3). We also study Hydrophobicity plot of HPLC / Parker Hydrophilicity Prediction Result Data found between 111-115 (Maximum Score 5.1) i.e., the maximum predicted residues at the position 115(Residue is D) is 112- EYSDYTD-118 and at position 116(Residue is Y) with start and end position is 113- YSDYTDE-119 (Figure 4), BepiPred predicts the location of linear B-cell epitopes Result found at position 115, the residue is D and the maximum score is 1.101 (Figure 5), Kolaskar and Tongaonkar antigenicity methods (Figure 6) Predicted peptides result found i.e., 22-DWFHCFGCSFLLMILVFVVFLFY-44, 48-GSRYYYK-54,61- RFIEFFCSIFPSLVLLILMVPSLSLLYE-88, 96-SDLNVGVVGH-105, 121-GFDSYML-127,133-ILGDLRLLDVDNRCVIPSGVSVGFLIGSE DVIHSWALPCMSIKVDAVGGAISRVTCVFPLIGLYYGQCSEICG AYHSFMPIVIE-216 (Table 1). The average antigenic propensity for protein found is 1.0660 and the predicted antigenic fragments can bind to MHC molecule is the first bottlenecks in vaccine design.


Figure 1: Guinea worm life cycle and interventions to interrupt transmission [6].


Figure 2: Hydrophobicity plot of Hopp and Woods (1981) of cytochrome c oxidase subunit II.


Figure 3: Hydrophobicity plot of Welling et al. (1985) of cytochrome c oxidase subunit II.


Figure 4: Hydrophobicity plot of HPLC/Parker et al. (1986) of cytochrome c oxidase subunit II.


Figure 5: Bepipred Linear Epitope Prediction Graph of cytochrome c oxidase subunit II.


Figure 6: Kolaskar and Tongaonkar Antigenicity Prediction Graph of cytochrome c oxidase subunit II.

There are 6 antigenic determinants in cytochrome c oxidase subunit II protein sequence
n Start Position Sequence End Position
2 48 GSRYYYK 54
5 121 GFDSYML 127

Table 1: Kolaskar and Tongaonkar Antigenicity Prediction Graph of cytochrome c oxidase subunit II.

Solvent accessible regions

We also predict solvent accessible regions in proteins; different measurement was performed for the prediction of antigenic activity, surface region of peptides. Emini et al. (Figure 7) predicts the highest probability i.e., found at position 51(Residue is Y) with start and end position is 49- SRYYYK-54(Maximum score 7.499) and at position 52 (Residue Y) with start and end position is 50- RYYYKS-55(Maximum score 7.499), that a given protein region lies on the surface of a protein and are used to identify antigenic determinants on the surface of proteins. Karplus and Schulz (Figure 8) high score (1.061) is found at position 129(Residue S) with start and the end position 126- MLPSEDM-132. Predict backbone or chain flexibility on the basis of the known temperature B factors of the a-carbons. The hydrophobic and hydrophilic characteristics of amino acids is determined by using different scales that are rich in charged and polar residues i.e., Sweet et al. hydrophobicity prediction Result Data found high in position 3543 i.e., 35-ILVFVV FLFYN-43 (Figure 9), Kyte and Doolittle result high in position 36 with maximum score 3.689 (Figure 10), Abraham and Leo result high in position: 39, Score: 2.243 (max) (Figure 11), Bull and Breese result high in position: 202, Score: 0.378 (max) (Figure 12), Miyazawa result high in position: 35, Score: 8.501 (max) (Figure 13), Roseman result high in position: 39, Score: 1.797 (Figure 14), Wilson et result high in position: 40, Score: 6.722 (Figure 15), Cowan result high in position: 39, score: 1.628 (Figure 16), Rose et al. result high in Position: 39, Score: 0.867 (max) (Figure 17), Eisenberg et al. result high in Position: 39, Score: 1.146 (max) (max) (Figure 18), Rao and Agros results high at position: 39, Score: 1.467 (max) (Figure 19), Manavalan et al. result high at position: 36, Score: 15.099 (max) (Figure 20). In this study, we found the antigenic determinants by finding the area of greatest local hydrophilicity. Hopp and Woods hydrophobicity scale is used to identify of potentially antigenic sites in proteins by analyzing amino acid sequences in order to find the point of greatest hydrophilic. Hydrophilicity Prediction result data found high in sequence position at 55-60 (55-SFEDDY-60) in a protein this scale is basically a hydrophilic index where apolar residues have been assigned negative values. The Window size of 5-7 is good for finding hydrophilic regions, greater than 0 values are consider as hydrophilic which is consider as antigenic. Welling used information on the relative occurrence of amino acids in antigenic regions to make a scale which is useful for prediction of antigenic regions and the predicted result data found high in sequence position 142-146 (142- VDNRC-146). Welling antigenicity plot gives value as the log of the quotient between percentage in a sample of known antigenic regions and percentage in average proteins. We also study Hydrophobicity plot of HPLC / Parker Hydrophilicity Prediction Result Data found between 111-115 (Maximum Score 5.1) i.e., the maximum predicted residues at the position 115 (Residue is D) is 112- EYSDYTD-118 and at position 116 (Residue is Y) with start and end position is 113- YSDYTDE-119 (Table 2). BepiPred predicts the location of linear B-cell epitopes Result found in position 115, the residue is D and the maximum score is 1.101 (Table 3). There are 6 antigenic determinant sequences is found by Kolaskar and Tongaonkar antigenicity scales the results show highest pick at position Predicted peptides result found i.e., 22-DWFHCFGCSFLLMILVFVVFLFY-44, 48-GSRYYYK-54, 61-RFIEFFCSIFPSLVLLILMVPSLSLLYE-88, 96-SDLNVGVVGH-105, 121-GFDSYML-127,133-ILGDLRLLDVD NRCVIPSGVSVGFLIGSEDVIHSWALPCMSIKVDAVGGAISRVTC VFPLIGLYYGQCSEICGAYHSFMPIVIE-216. Result of determined antigenic sites on proteins has revealed that the hydrophobic residues if they occur on the surface of a protein are more likely to be a part of antigenic sites. This method can predict antigenic determinants with about 75% accuracy and also gives the information of surface accessibility and flexibility. Further this region form beta sheet which show high antigenic response than helical region of this peptide and shows highly antigenicity. We predict Solvent accessibility by using Emani et al. the result found the highest probability i.e., found at position 51(Residue is Y) with start and end position is 49- SRYYYK-54(Maximum score 7.499) and at position 52 (Residue Y) with start and end position is 50- RYYYKS-55(Maximum score 7.499), that a given protein region lies on the surface of a protein and are used to identify antigenic determinants on the surface of proteins. This algorithm also used to identify the antigenic determinants on the surface of proteins and Karplus and Schulz predict backbone or chain flexibility on the basis of the known temperature B factors of the a-carbons here we found the result with high score (1.061) is found at position 129 (Residue S) with start and the end position 126- MLPSEDM-132. We predict Solvent accessibility of cytochrome c oxidase subunit II for delineating hydrophobic and hydrophilic characteristics of amino acids. Solvent accessibility used to identify active site of functionally important residues in membrane proteins. Solvent-accessible surface areas and backbone angles are continuously varying because proteins can move freely in a threedimensional space. The mobility of protein segments which are located on the surface of a protein due to an entropic energy potential and which seem to correlate well with known antigenic determinants. We also found the i.e., Sweet et al. hydrophobicity prediction Result Data found high in position 3543 i.e., 35-ILVFVV FLFYN-43, Kyte and Doolittle result high in position 36 with maximum score 3.689, Abraham and Leo result high in position:39, Score: 2.243 (max), Bull and Breese result high in position: 202, Score: 0.378 (max), Miyazawa result high in position: 35, Score: 8.501 (max), Roseman result high in position:39, Score: 1.797, Wilson et result high in position:40, score: 6.722, Cowan result high in position:39, Score: 1.628 Rose et al. result high in Position: 39, Score: 0.867 (max), Eisenberg et al. result high in Position: 39, Score: 1.146 (max) (max), Rao and Agros results high at position: 39, Score: 1.467 (max), Manavalan et al. result high at position: 36, Score: 15.099 (max). These scales are a hydrophilic with a polar residues assigned negative value. Because the N- and C- terminal regions of proteins are usually solvent accessible and unstructured, antibodies against those regions recognize the antigenic protein. We found that the region of maximal Hydrophilicity is likely to be an antigenic site, having hydrophobic characteristics, because the terminal regions of antigen protein is solvent accessible and unstructured, antibodies against those regions are also likely to recognize the native protein. It was seen that an antigen protein is hydrophobic in nature and contains segments of low complexity and high-predicted flexibility. The predicted antigenic protein segments of cytochrome c oxidase subunit II (mitochondrion) can take active part in the host immune reactions. In future study the predicted antigenic protein cytochrome c oxidase subunit II (mitochondrion) fragments can be used in the investigation of MHC molecules binding via utilizing the bioinformatics tools and software, and it can be the first bottlenecks in vaccine design.


Figure 7: Emini Surface Accessibility Prediction Graph of cytochrome c oxidase subunit II.


Figure 8: Karplus and Schulz Flexibility Prediction Graph of cytochrome c oxidase subunit II.


Figure 9: Hydrophobicity plot of Sweet et al. (1983) of cytochrome c oxidase subunit II.


Figure 10: Kyte and Doolittle hydrophobicity plot of cytochrome c oxidase subunit II.


Figure 11: Abraham and Leo hydrophobicity plot of cytochrome c oxidase subunit II.


Figure 12: Bull and Breese use surface tension to measure hydrophobicity and also uses negative values to describe the hydrophobicity of cytochrome c oxidase subunit II.


Figure 13: Hydrophobicity plot of Miyazawa et al. (1985) of cytochrome c oxidase subunit II.


Figure 14: Hydrophobicity plot of Roseman MA (1988) of cytochrome c oxidase subunit II.


Figure 15: Hydrophobicity/HPLC plot of Wilson et al. (1981) of cytochrome c oxidase subunit II.


Figure 16: Hydrophobicity/HPLC pH 3.4/ plot of Cowan (1990) of cytochrome c oxidase subunit II.


Figure 17: Hydrophobicity plot of antigen by Hphob/ Rose et al. scale of cytochrome c oxidase subunit II.


Figure 18: Hydrophobicity plot of antigen by Hphob/Eisenberg et al. scale of cytochrome c oxidase subunit II.


Figure 19: Antigenicity plot of antigen protein by Hphob./Rao and Argos, scale of cytochrome c oxidase subunit II.


Figure 20: Antigenicity plot of antigen protein by Hphob./Manavalan et al. scale of cytochrome c oxidase subunit II.

Parker Hydrophilicity Prediction-Predicted residue scores Position Residue Start End Peptide Score
110 S 107 113 WYWSYEY -1.629
111 Y 108 114 YWSYEYS 0.729
112 E 109 115 WSYEYSD 2.429
113 Y 110 116 SYEYSDY 3.586
114 S 111 117 YEYSDYT 3.4
115 D 112 118 EYSDYTD 5.1
116 Y 113 119 YSDYTDE 5.1
117 T 114 120 SDYTDEV 4.843
118 D 115 121 DYTDEVG 4.729
119 E 116 122 YTDEVGF 1.986
120 V 117 123 TDEVGFD 3.686

Table 2: Parker Hydrophilicity Prediction-Predicted Residue Scores Table.

Bepipred Linear Epitope Prediction-Predicted residue scores Position Residue Score Assignment
110 S 0.02 -
111 Y 0.108 -
112 E 0.358 E
113 Y 0.575 E
114 S 1.014 E
115 D 1.101 E
116 Y 1.06 E
117 T 1.009 E
118 D 0.829 E
119 E 0.893 E
120 V 0.772 E

Table 3: Bepipred Linear Epitope Prediction -Predicted Residue Scores Table.


An antigenic protein can plays an important role in vaccine development. The peptide fragments of antigen protein can be used to select naonamer for use in rational vaccine design and can develop the understanding of roles in the immune system in infectious disease. Overall, the results are encouraging, both the ‘sites of action’ and ‘physiological functions’ can be predicted with very high accuracies helping minimize the number of validation experiments. From the above result and discussion it is concluded that an antigenic protein cytochrome c oxidase subunit II from D. medinensis can play an important role in the vaccine development.

Conflicts of Interest

The authors declare no conflict of interest.


Select your language of interest to view the total content in your interested language
Post your comment

Share This Article

Recommended Conferences

  • Global Summit on Immunology and Cell biology
    May 11-12, 2018 Osaka, Japan
  • Antibody Engineering Meeting associated with 9th European Immunology Conference
    June 14-16 2018 Rome, Italy
  • International Conference on Clinical and Cellular Immunology
    August 6-7, 2018 Madrid, Spain
  • International Conference on Tumor & Cancer Immunology and Immunotherapy
    September 17-18, 2018 San Diego, USA
  • World Congress and Expo on Immunology
    October 19-20, 2018 Baltimore, USA

Article Usage

  • Total views: 8148
  • [From(publication date):
    June-2016 - Dec 14, 2017]
  • Breakdown by view type
  • HTML page views : 8068
  • PDF downloads : 80

Review summary

  1. Lionel
    Posted on Aug 12 2016 at 12:23 pm
    The authors studied the various aspects of the Cytochrome c oxidase subunit II(oligomeric enzyme). In this study Cytochrome c oxidase subunit 2 protein is investigated for its role in antigenicity. Several different types of B- cell epitope prediction methods were utilized. This wonderful research concerns the investigation of MHC molecules binding and vaccine designing.

Post your comment

captcha   Reload  Can't read the image? click here to refresh

Peer Reviewed Journals
Make the best use of Scientific Research and information from our 700 + peer reviewed, Open Access Journals
International Conferences 2017-18
Meet Inspiring Speakers and Experts at our 3000+ Global Annual Meetings

Contact Us

Agri & Aquaculture Journals

Dr. Krish

[email protected]

1-702-714-7001Extn: 9040

Biochemistry Journals

Datta A

[email protected]

1-702-714-7001Extn: 9037

Business & Management Journals


[email protected]

1-702-714-7001Extn: 9042

Chemistry Journals

Gabriel Shaw

[email protected]

1-702-714-7001Extn: 9040

Clinical Journals

Datta A

[email protected]

1-702-714-7001Extn: 9037

Engineering Journals

James Franklin

[email protected]

1-702-714-7001Extn: 9042

Food & Nutrition Journals

Katie Wilson

[email protected]

1-702-714-7001Extn: 9042

General Science

Andrea Jason

[email protected]

1-702-714-7001Extn: 9043

Genetics & Molecular Biology Journals

Anna Melissa

[email protected]

1-702-714-7001Extn: 9006

Immunology & Microbiology Journals

David Gorantl

[email protected]

1-702-714-7001Extn: 9014

Materials Science Journals

Rachle Green

[email protected]

1-702-714-7001Extn: 9039

Nursing & Health Care Journals

Stephanie Skinner

[email protected]

1-702-714-7001Extn: 9039

Medical Journals

Nimmi Anna

[email protected]

1-702-714-7001Extn: 9038

Neuroscience & Psychology Journals

Nathan T

[email protected]

1-702-714-7001Extn: 9041

Pharmaceutical Sciences Journals

Ann Jose

[email protected]

1-702-714-7001Extn: 9007

Social & Political Science Journals

Steve Harry

[email protected]

1-702-714-7001Extn: 9042

© 2008- 2017 OMICS International - Open Access Publisher. Best viewed in Mozilla Firefox | Google Chrome | Above IE 7.0 version